SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa025386m|PACid:17664742 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa025386m|PACid:17664742
Domain Number 1 Region: 30-123
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.15e-16
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa025386m|PACid:17664742
Sequence length 149
Sequence
DEMGEPQMEDLSTSNPVIELEGDEFWPLSGKPFFDVVLTKTSIKPMCQLVVPGKFSATLP
SCSIPTVLTFRGKNWEMTYHGSSNYKRLDNWKAFAIDNNLKVGDACVFEQLECSSTRLVF
RVQILRGDIPSEFLDKLDGDNVDAPIVLE
Download sequence
Identical sequences M5X861
ppa025386m|PACid:17664742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]