SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa000287m|PACid:17662989 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa000287m|PACid:17662989
Domain Number 1 Region: 587-768
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000118
Family Tropomyosin 0.0012
Further Details:      
 
Domain Number 2 Region: 338-583
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000118
Family Tropomyosin 0.00037
Further Details:      
 
Weak hits

Sequence:  ppa000287m|PACid:17662989
Domain Number - Region: 773-858
Classification Level Classification E-value
Superfamily Tropomyosin 0.00216
Family Tropomyosin 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa000287m|PACid:17662989
Sequence length 1341
Sequence
MQVSNGDLPPVEHEGKKEEEEATFDGEFIKVERESLDVKDGSHAAEPALVEDKPSVIERS
SSNSSRELLEAREKVSDLELEIERLAGVLKHSESENSELKNEVLLRKEKLEESGEKYEEL
ELSHKKLQEQIVEAEEKYSSQLNVLQETLQAQEKKHKDLVGVKEAFDGLSLELESSRKRL
QELEQELQSSAGEAQKFEELHKQSGSHAETETKRALEFEKLLEVAKLSAKEMEDQMACIQ
EELKGLYEKIAEDEKVKEALNSTAAELSAVQEELALSKSQGVDLEQKLSAKEALINELTE
ELGLKKASESQVKEDISALENLFASTKEDLDAKVSELEEIKLKLQKELSAKELVEAAQKT
HEEESLVVQEKLAIVTKEKEALEAAVVDLTGNVQLTKDLCSDLEEKLKLSEENFGKTDAL
LSQALSNNAELEQKLKSLEEFHNEAGASFATATQKNLELEEEAKLQLRELETRFIAAEEK
NAELEQQVNVVELNRGIAEGGLEELSEKLSALSTTLAEVEEEKKQLNGQVQEYQEKISQL
ESSLDQSSLQNSELQEELKIATEKCAEHEGRASTHHQRSLELEDLFQLSHTKAEDTGKKV
SELELLLETEKFRIQELEEQISALEKKCLDAEADSKNYSNKISELSSELEAFQARTSSLE
VALQAANEKERELTEALNVATEEKIRLEDASNNSSEKLSEAENLLEVLRNELNLTQGKLE
NIENDLKEAGIREGEVIVKLKSAEEQLEQQGKVIEQTTSRNSELEALHESLVRDSEIKLQ
EAIGSFTNRDAEANSLLEKLKILEDQVKVYEEQVAEAAEKYASLKEELDNSLTKLASSES
TNEELSKQILEAENKASQSLSENELLVDTNVQLKSKIDELQELLNSALSEKEATTKELVA
HKSTVEELTDQHSRACDLHSSAEARVAEAETKLQEAIQRFSQRDLEAKDLLEKLDAREGQ
IKLYEAQAQETSSVSETRKAELEETLLKLKHLESIVEELQTKLAHFEEESRKLAEANIKL
TEEVSIYESKLSDVEAKNFTALAEKEETVEQLQASKKTIEDLTEQLSLEGQKLQSQISSV
MDENSLLNELNQNIKKELQQVISQLEEQLKEHKAGEDALKSEVENLKAEIAEKSLLEKSL
KELEEQLVKTEAQLKQEVESVKSAAAEREAELTSKLEDHAHKVHDRDLLNEQVVKLQSEI
HIAQATVAEKKEADSQKDLEREASLKHSLEELEAKNKEITLLEKQVKDLEQKLQLADAKL
TERGDANVAGLEVKSRDIGSTISTPSKRKSKKKSEAALAQTSSSSEIHTHTAEASPLMSI
KFIVGVAVVSAIIGIILGKRY
Download sequence
Identical sequences M5WX95
ppa000287m|PACid:17662989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]