SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa001608m|PACid:17655223 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa001608m|PACid:17655223
Domain Number 1 Region: 646-742
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.16e-22
Family B3 DNA binding domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa001608m|PACid:17655223
Sequence length 793
Sequence
MKGKQVQVHHHQDLHAGDLHHHHMKDANIPISDGFGGGGAMEELEDQEDNLGVDPSEMWL
DDNDQETALLADVNDPSIFYNDHFPPLPDFPCMSSSSSSSSTPAPVKSATSSSTSSSVSS
SSSAASWAILRSDAEEDGERRHHHNSYNHLHQYSQGDDQAVDAHALSSTASMEISQPSDL
SREGGAMDCMGAMETFGYMDLFESNEFFDPSSIFQSDSLLMEQFQQDDDHQQLLAPHQLQ
DPNEATAIIPQQQQEQEVAVRDEENNKEDDQNENKEPDDMAMVFLEWLRSNRETVSAEDL
RSVKIKKSTIECAARRLGGGKEAMKQLLKLVLEWVQTNHLQKRRSNSLTTKDADIVAQDP
FQNPNPNTSPRVLESNPSCSFTQTPWMAPPPHAAYDQAGGILVPTPPPAAYPSMMGYIAP
DQYVNGPGPYQPSPEYHHMIDSGQPTWPSSPFGMGTAHYGSFPDNNIHLAPPPQHHPQAF
AGYGSQYQPYQYFPLNGEHQLMRLGSSATKEARKKRMARQRRLVSHHRHGHQQQQHLNAQ
MPDHLLHQQHTRLVGNAADLNCTNTVPLQANPGNWFYWPTATAAPSQSPAMMPSITQEAA
PPPPLQQMDRPASTQAQNYNQGRSSAAQERQERRQGWKSEKNLKFLLQKVLKQSDVGSLG
RIVLPKKEAETHLPELEARDGISIPMEDIGTSHVWNMRYRYWPNNKSRMYLLENTGDFVR
ANGLQEGDFIVIYSDVKCNKYMIRGVKVRHAGAKSEGNKRPGKSQRNQHASTPAGTNGSS
PSSASASATHKKQ
Download sequence
Identical sequences M5W5U1
XP_007200956.1.23749 ppa001608m|PACid:17655223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]