SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa001811m|PACid:17645683 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa001811m|PACid:17645683
Domain Number 1 Region: 396-686
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-75
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 18-153
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000167
Family Universal stress protein-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa001811m|PACid:17645683
Sequence length 761
Sequence
MVQENYGEQAEMESSGGRSVVVGVKLDAKSRELLTWALVKVAQPGDRVIALHVLGKNEIV
DQDGKSSLLSLVKAFDSVLAVYEGFCNLKQVDLKLKICRGASVKKFLVREANSYTASKVI
VGTAQNHHKIRSSTTVAEYCAKKLSKDCGVLAVNNGKVVFNREGSQTTYCDPQGSEDRRR
NGLLTAFHRSLHKSSKVLNEGSDSVALKDTYGPVDCQKLEQGFAKLFLESSETVAKQKCS
ICSRPSVDNSCHQSAVESSADDGEDRSMAIVPVQKEEEAAASSISMLIRELPEARPGWPL
LRRAVLPDQQISERSLVRKISVVQWAMQLPSRQPSATSNFDDRRSSCDPGEDQPFCLNGE
SGAIVAVGSEAVTAPPSPDHSSKGLPKELEGLHEKYSATCRLFTYKELQSATSYFLAENF
IGRGGSSQVYRGCLPDGKELAVKILKPSEDVLKEFVLEIEIITTLNHNNIISLLGFCFED
NNLLLVYDFLSRGSLEENLHGSKKDPLTFGWNERYKVAVGVAEALDYLHTSSAQPVIHRD
VKSSNILLSDDFEPQLSDFGLAKWASTSSSHITCTDVAGTFGYLAPEYFMYGKVNDKIDV
YAFGVVLLELLSGRKPISSDYPKGHESLVMWAKPILSGGKVSQLLDPCLSNDYNQDQIER
MVLAATLCIRHAPRARPQMSFIVKLLQGDADAIKWARLQVHALEESDVLEDEACPRSNLQ
SHLNLALLDVEDDSLSMSSIEQSVSLEDYLKGRWSRSSSFD
Download sequence
Identical sequences M5XLP6
XP_007225237.1.23749 ppa001811m|PACid:17645683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]