SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa002094m|PACid:17667483 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa002094m|PACid:17667483
Domain Number 1 Region: 354-643
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-74
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 14-143
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000000649
Family Universal stress protein-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa002094m|PACid:17667483
Sequence length 717
Sequence
MKLLTGEGGGGGGKTVVVGVKLDSHSKELLTWALVKVAEPGDNVIAIHVLEDHLHTPSEG
TSSLLSLVKTFDSVLSAYEGFCNLKQVDLKLKVCRGNSVRKLLVQEAKSYNAAATIVGTS
KTHHRIGSSASVAKYCARKLSRSFSVFAVDNGKVVFKRNGPDSNADKIQVPNDAKLNQCR
HLIRKPCSKCGKKTLKRNCENCAADSVFRGTSGTQLIDESEGEDGEENSLALVPIQRLDI
SSNSIKIQDSQCFKPGWSLLRHTFLPKRQCMEKTEKKTSVFGWALRPLSWNTSAVVYPDH
KLVNPGQDQDCSSMLNGISGAIVPFGPNAVCPPLSPHHGMEPLPEEFLDLCKKYSSSCRL
FCYKELLLATSNFRPENMVGKGGSSSVYRGCLSDGKELAVKLLKPSGDILNEFVHEIEIL
TTLNHKNIISLFGFCFDENNLLLVYNFISRGSLEENLYGNKKDGNAFGWKQRYNVAVGVA
EALDYLHYGCEEPVIHRDVKSSNILLSDDFEPQLSDFGLASWASTSSDISSTDVAGTFGY
LAPEYFMHGKVSDKIDVYAFGVVVLELLSGRKPIYSKDTKGQESLVMWAKPILKSGNVAQ
LLDPSLGSDYDQDQIERMVLAANLCIRHTPKLRPPINLVLKLLQGDEEVTRCARQQVSAS
EELEALDGEALPSDIQSHLNLALLDLEDDSLSTSSGEQSISLEDYLQGRWSRSSSFN
Download sequence
Identical sequences M5X2I1
ppa002094m|PACid:17667483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]