SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa002236m|PACid:17654147 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa002236m|PACid:17654147
Domain Number 1 Region: 349-433
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000621
Family Tropomyosin 0.004
Further Details:      
 
Domain Number 2 Region: 438-535
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000186
Family Tropomyosin 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa002236m|PACid:17654147
Sequence length 697
Sequence
MDYDGGPEASVSVNDVNIDDPEVDSSKVGNLESVSSDGVIVGELRSVGEVFTRVELDLAC
ASEKLVNLNVLMMHVATKESDLEALASKEEQTSVDFVEKAMEFVLLSGILDSEVSELDKL
MAILQAEITNAQGLLSSYTCLGETFVVVEDKLCDSEQSLKQLQDQISEIRMQSLKFQRTF
SCYDGEENWNANKGVVYLEDDKFSSMNLKINMQTVEQQRHILRMLEKSLAREMDLEKKLT
ESKQIEEDMKLRLLSSEQEAYCMEEEAADAWERWLQADNASEVLMGISKELLGKLHILQF
NLNGSVQREAELRLKLDGQVESRESSLRKLESSNAKLNSFLLDQTAGLKDSLKEAEDKLI
LADSEAFTLREKVSSLEEQHTVLCSDISELENVITDLKEKVSKAETRAENAEAKSKLLTE
TNMELNEEIGLLKSTGSASETVDSLERKLRESDTQLQHAVASAEASLEKQQMLYSTINDM
GSVIKDLKQKVLKAESRTDSAEDNCIRLSESNALLTEELSFLRGRLACMEASLHQAEEVK
VATATDIGIRSKVLTSLVVQLAFERERLHKQISSLAVENKTLVLKLQTNNSPSVEMGNDD
RGNHKDFMPSKHGLATGTRESEEEADELSDGNCKLDETQNNVSVGETKVGPTDSTSEFET
ARRIDAGVLSFKHFLMAMLILLISVAAYFFLQQDCPF
Download sequence
Identical sequences M5WQX1
XP_007214993.1.23749 ppa002236m|PACid:17654147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]