SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa002476m|PACid:17662479 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa002476m|PACid:17662479
Domain Number 1 Region: 306-640
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.26e-86
Family IF2B-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa002476m|PACid:17662479
Sequence length 669
Sequence
MDTRRPPRTVSNPKVRQVGFFSSPEPIAASSPPVSHISPSGNSLSPVMIPPPRHSDAPRP
VPFPAVPASPVRRDSIPAGSYNNSSDFFPASPPTASSSYGMVMGSGEFLNDVVMSPGRAL
RGNSVRAAAGITTSSSFPGGGFDLTAAVKASSVPASGLTTVSVVKMPITGISEKGRGASV
EAQSERGGNSKPLKEKTTKAERRALQEAQRAAKAAAKADGSKTPSVAATVTASTSAAANV
KPSKATKLVSQTSVAASEKKGGGERLPEKERKKEVPHPRMQYDDTSRVEKAKRRSVVKQT
EARNRVELFRHLPQYEHGTQLPDLESKFFQLDPVHPAVYKVGLQYLSGDISGGNARCIAM
LLAFQEAIKDYSTPPEKNLSRDLTAKISSYVSFFIECRPLSVTMGNAIRFLKSRIAKLPL
SMSESEAKASLQSEIERFITEKIILADKVIVKHAVSKIRDGDVLLTYGSSSAVEMLLLHA
HELGKQFRVVVVDSRPKLEGQRLLRRLVGKGLSCTYTHINAASYIMHEVTRVFLGASSVL
SNGTVYSRVGTACVAMVAHAFRVPVLVCCEAYKFHERVQLDSICSNELGDPDAISKIPGR
EEIYLDGQANCENLQPLNLIYDALPSDYVSMIITDYGMVNQFFLQLLLQDLKSRQCFAIL
YVPNFELAF
Download sequence
Identical sequences M5X3V8
ppa002476m|PACid:17662479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]