SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa002668m|PACid:17654546 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa002668m|PACid:17654546
Domain Number 1 Region: 292-639
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.26e-91
Family IF2B-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa002668m|PACid:17654546
Sequence length 646
Sequence
MDARRASRTVIDPKVRQVGFFTPNAETAPSRTLSGPPIASSPPLSSSPASNSLYPVMIPP
SRHLSDTIAIRTAALPVPESASRRKEAGERVPVGSYNPSESLLGTSPVTASPSSRVGDAT
LEFSDESSVRWYRRSDSGKLASSFPGGGFDSATVKAPLEVPEKSGEEVSKEQKEVPSNSE
PLKSKTTTKAERRALQEAQRAAKAAAKAEGKKPAAVTRGGAPGKPAKQSLQKRDPPPVAS
SVAASDKKGGDRPPEKERKKDVPPPRMQFDDKNRVDKAKRRAVVNQTEAKNRVELFRHLP
QYEHGTQLPDLESKFFQLDPMHPAIYKVGLQYLAGEISGGNARCIAMLQAFQEAIRDYTT
PPEKTLVRDLTAKISSYVSFFIECRPLSISMGNAIRFLKSRIAKLPLTLSESEAKSTLCS
EIDRFINEKIILADKVIVRHAATKVRDGDVLLTYGSSCVVEMILLYAHELGKQFRVVVVD
SRPKLEGQALLRRLVAKGLSCTYTHINAVSYIMHEVTRVFLGAASVLSNGTVYSRVGTAC
VAMVAHAFCVPVLICCEAYKFHERVQLDSICSNELGDPDAIAKVSGRTDVNYLDNWANKE
NLQLLNLMYDATPSDYISMIVTDYGMIPPTSVPVIVREYGREHLWA
Download sequence
Identical sequences M5WXG3
XP_007210291.1.23749 ppa002668m|PACid:17654546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]