SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa003179m|PACid:17666603 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa003179m|PACid:17666603
Domain Number 1 Region: 412-534
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.71e-19
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa003179m|PACid:17666603
Sequence length 595
Sequence
MASQCLMQNWLDLNQYTDSADSGFVPLFVYAIFGSSRQLAVGPVALVSLLVSNVLSGIVD
SSDELYTELAILLAFMVGVMECLLGLFRLGWIIRFISHSVISGFTTASAIVIALSQAKYF
LGYNVARSSKIVPLIKSIISGADGFSWPPFVMGSVILAILLIMKHLGKTRKYLRFLRAAG
PLTAVLSGTIFVKIFNPSSISLVGDIPQGLPSFSIPRAFGYATSLITTALLITGVAILES
VGIAKALAAKNGYELDSNQELFGLGVANIFGSFFSAYPTTGSFSRSAVNHESGAKSGLSG
LVMGVLMGCALLFMTPLFEYIPQCALAAIVISAVIGLVDYEEAIFLWGVDKKDFLLWTIT
STTTLFLGIEIGVLVGVGVSLAFVIHESANPHIAVLGRLPGTTVYRNTQQYPEAYTYNGI
VIVRIDAPIYFANISYIKDRLREYEVEVDRSTSRGPEVERIYFVIIEMAPVTYIDSSAVQ
ALKDLYQEYKLRDIQIAISNPNREVLMTLSRAGVVDLIGKEWYFVRVHDAVQVCLQHVQS
LKETPKAADPSSEERLSPFQRLIKQRAEDSSVAELESGSKDIDPQLEPLLSRKSS
Download sequence
Identical sequences M5X2I8
ppa003179m|PACid:17666603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]