SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa003255m|PACid:17666604 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa003255m|PACid:17666604
Domain Number 1 Region: 406-528
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.51e-19
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa003255m|PACid:17666604
Sequence length 589
Sequence
MQNWLDLNQYTDSADSGFVPLFVYAIFGSSRQLAVGPVALVSLLVSNVLSGIVDSSDELY
TELAILLAFMVGVMECLLGLFRLGWIIRFISHSVISGFTTASAIVIALSQAKYFLGYNVA
RSSKIVPLIKSIISGADGFSWPPFVMGSVILAILLIMKHLGKTRKYLRFLRAAGPLTAVL
SGTIFVKIFNPSSISLVGDIPQGLPSFSIPRAFGYATSLITTALLITGVAILESVGIAKA
LAAKNGYELDSNQELFGLGVANIFGSFFSAYPTTGSFSRSAVNHESGAKSGLSGLVMGVL
MGCALLFMTPLFEYIPQCALAAIVISAVIGLVDYEEAIFLWGVDKKDFLLWTITSTTTLF
LGIEIGVLVGVGVSLAFVIHESANPHIAVLGRLPGTTVYRNTQQYPEAYTYNGIVIVRID
APIYFANISYIKDRLREYEVEVDRSTSRGPEVERIYFVIIEMAPVTYIDSSAVQALKDLY
QEYKLRDIQIAISNPNREVLMTLSRAGVVDLIGKEWYFVRVHDAVQVCLQHVQSLKETPK
AADPSSEERLSPFQRLIKQRAEDSSVAELESGSKDIDPQLEPLLSRKSS
Download sequence
Identical sequences M5XM51
ppa003255m|PACid:17666604 XP_007218936.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]