SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa003541m|PACid:17642604 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa003541m|PACid:17642604
Domain Number 1 Region: 228-327
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-23
Family B3 DNA binding domain 0.0059
Further Details:      
 
Domain Number 2 Region: 449-549
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.51e-22
Family B3 DNA binding domain 0.0086
Further Details:      
 
Domain Number 3 Region: 11-110
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-22
Family B3 DNA binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa003541m|PACid:17642604
Sequence length 567
Sequence
MAEEAQKETSNARRPHFFAFYSADLSSERLKIPERFMIHMEGRTSGLVSLFGPSGNAWNV
DLIQKNGDLFFHHGWPAFVRDHFVECGDFLIFRYDGELCFTVLIFDQSACEKEAAFHSEC
GQDSSNFEKYMGRKRGREEAASSGKLVDGVAKKMRDSSSEEGCGHEGVMCEEATCSKEIK
RAEKPGLDIVLCKANASIQNMCGKGDGLNVNGRVCVQMSSAHEIAQSFSSSNPYFVRIMK
SFNISGSYTLNIPCKFSVAHLPNCKVKLVLHNWKGESWTVNSVPSTRVHTSHTLCGGWMA
FVRYNDIKLGDICIFELVRECEFRVHVQSGETSSWLSAELALPSIKTFKSLSKIMTGNSP
KVHSKSIRKIEKADKIAPKKFQEAAFTNDARKYGSTSKSLTKVSLSQSKAASKKLVNHRK
KVVEDELNPGSSLRMRLTLDEERAARSFASCFPSFVKIMKKFNICGSYTLKIPYQFSTEH
LPNYKTEIVLRNSKGECWTVNSVPDSKGRVVHTFCGGWMAFVRGNDVNIGDICIFELVGK
REMQVHISGVGKKGFDHQDGEATSNAV
Download sequence
Identical sequences M5XC50
ppa003541m|PACid:17642604 XP_007221817.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]