SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa006329m|PACid:17650697 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa006329m|PACid:17650697
Domain Number 1 Region: 3-95,176-406
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 6.51e-84
Family IF2B-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa006329m|PACid:17650697
Sequence length 417
Sequence
MPDVHSLVNDFLIKLKKRNIEGSQATAKLTAELLRSVISSQRVPYTNQAGALIDAVKAVG
EQLIAANPIELAVGNIVRRVLHIIREEDLSLTTAAMAGLNMSTVSDDEDDGEHDNHPVLS
AAVVAAAARSTLRPPSLQTLLEDMPDAAAVPHTSSSGGDSEEKTKSADKSSRSRKLKHDV
IEAVNELIQDIGTCHEQIAEQAVEHIHQNEVILTLGSSKTVLEFLCAANEKKRSFRVFVA
EGAPRYQGHLLAKELVARGLQTTLITDSAVFAMISRVNMVIVGAHAVMANGGVIAPVGLN
MVALAAQRHAVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCMDFGSGTA
SPLLHVVNPTFDYVPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRRPAIGS
Download sequence
Identical sequences M5X1B4
XP_020412498.1.23749 ppa006318m|PACid:17650698 ppa006329m|PACid:17650697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]