SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa007089m|PACid:17669079 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa007089m|PACid:17669079
Domain Number 1 Region: 16-362
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.05e-113
Family IF2B-like 0.0000000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa007089m|PACid:17669079
Sequence length 382
Sequence
MALNSEFTEGTEAANSLQSICYKRGSLQLLDQRKLPLQTTYLDIRDSTDGWHAIKDMVVR
GAPAIAIAAALSLAVEVFNLEDFNGTPDEAFSFIVMKLEYLVSSRPTAVNLSDASAKLRQ
IASTVAAATSDAKNVFEAFIEASEIMLKDDVASNKAIGSYGASFIQHLLENSKSISMLTH
CNTGSLASAGYGTALGVIRSLHTEGVLERAYCTETRPFNQGSRLTAFELVHDNIPATLVV
DSAAAALMKDGRVNAVVVGADRVAANGDTANKIGTYSLAVSAKYHNIPFFVAAPLTSVDL
ALSSGQEIIIEERSPKELLHSQGGLGEQVAASGISVWNPAFDVTPANLIAGIITEKGVIT
KKGTDAFDIKGFVQKAALQSGA
Download sequence
Identical sequences M5W969
XP_007202151.1.23749 XP_020424254.1.23749 ppa007089m|PACid:17669079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]