SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa011554m|PACid:17655125 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa011554m|PACid:17655125
Domain Number 1 Region: 90-187
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000294
Family B3 DNA binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa011554m|PACid:17655125
Sequence length 206
Sequence
MAEACKQVKIYDRSACEKNVEVAERRSGSPVSLVNKGNQAQVKNEIVELDTEDCENKTID
SDRRSCKYPISEKRPVSFCVQETSTGSILFKSENPCFLVCSRKQHLLYRVTIPNKLAVAE
GLRGRDAVILQDPTGRSWLVELRVECVNRLDMAIGWTECRKANQISPGDSIIFELVEQGV
MQFHIFRGAVRGNRLSVITAAPNVKN
Download sequence
Identical sequences M5X2H2
ppa011554m|PACid:17655125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]