SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa015558m|PACid:17644886 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa015558m|PACid:17644886
Domain Number 1 Region: 402-680
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-66
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 17-146
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.00000000285
Family Universal stress protein-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa015558m|PACid:17644886
Sequence length 777
Sequence
MALFRSRSVGEDVGPTLVAINKDKNSQCAVKWAVDNLLGDKNAHCTLIHVRSHSFHHHGR
PPTEAELQQFFLPYRGFCARKGIVAKEVVLHDIDVPNALVDYVVRNSICNIVVGASHHNA
LTRKFRPADVATSLLKSVPETCAVYVISKGKIQTSRSATGPQTPKSNGATPRNNSSQRTP
LSSFLHGVSAFEDVISQGSSAGRIPLDKKADFKHVPPKAHRSGSKTNSPTQSVTSVTSDK
LYHGNSMSGGSDFSGPLSFQSNGSDNVDFSMNSEGSINSFSSHTPLQSALDAEMRRLRLE
LKQTMDMYTSACKEALAAKEKTRDLQKWKTSEEHKLEEAKLAEEAALALADVERQKSKAA
TEAAQMAQRLAGMETHKRKIAERKAKQEAGERRRAMDALAHNHIRYRRYTIEEIELATDY
FKISNKVGEGGYGPVYRAWLDHTAVAIKVLRPDISQGQRQFQQEVEVLSCIRHPHMVLLV
GACPEYGCLIYEYMENGSLEDRLFLKSNTPPIPWGVRFKIAAEIATALLFLHQTKPEPLV
HRDLKPANILLDRNYVSKIADVGLARLVPPSVADAVTQYRVTAAAGTFCYIDPEYQQTGM
LGVKSDIYSLGVMLLQIITAKPAMGLSHQVEEAIEKGAFAETLDPAVTDWPVEEALSYAK
MALKCCELRRRDRPDLSTVILPELNRLRDLGMKNEANQCKKAAADGVCGENVELQEQFSA
QTRFCYIMQQQQQQQQKTCRKIKQEADGGLLVVCKQLLFCASCSTFEEVQFIWILMK
Download sequence
Identical sequences M5XGH4
ppa015558m|PACid:17644886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]