SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa015728m|PACid:17645680 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa015728m|PACid:17645680
Domain Number 1 Region: 262-370
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-16
Family Ankyrin repeat 0.0022
Further Details:      
 
Domain Number 2 Region: 48-184
Classification Level Classification E-value
Superfamily POZ domain 0.000000000022
Family BTB/POZ domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa015728m|PACid:17645680
Sequence length 590
Sequence
MEFKAGVSDSNDVVSNSNCYSSTISCIALSHYPSPPDISALTRLSDNLESILDSADFDFF
ADAKIVVNTGREVPVHRCILSARSSFFKNVFSAKDIGSGSAVRFELKELAKEYDVGLDSL
LAVLGHLYSGKLRSLPKGVCVCVDDACAHVSCRPVVDFIVEVLYASASFQISELVSLYQR
HLLDILEKVCIDDILVVLYVANMCGKACERLVGRCVEIIVKSDADVVTLEKALPQHTVKL
ITDSRLALGLDRPQCNTSVSHFPDKHTKRIHRALDSDDVELVRMLLKEAHANLDDAYALH
YAVAYCDAKTTTELLDLGLADVNHRNPRGYTVLHVAAMRKEPKIIVSLLTKGARPSDLTL
DGRKAVQITKRLTRAADFFKSNDEGKSSSNDRLCIEILEQAERRDPLLGEASLSLAMAGD
DLRMKLLYLENRVGLAKYLFPMEAKVVMDISQIDGASEFPIGGISSKDLASSQRTTVDLN
EAPFKIKEEHLLRLRALSRTVELGKRFFPRCSEVLNKIMDGDDISQLAYTGDDSPELRLL
KRRRYMELQEVLSKAFNEDKEEFDRSAVSSSSSSTSIGVVRSNGMLTLNQ
Download sequence
Identical sequences M5VSQ6
XP_007202872.1.23749 ppa015728m|PACid:17645680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]