SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa015816m|PACid:17656975 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa015816m|PACid:17656975
Domain Number 1 Region: 115-210
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.28e-16
Family B3 DNA binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa015816m|PACid:17656975
Sequence length 236
Sequence
MTSSTEEGAYLLLHLKHTILNPETARNLDHMKSKILSGIKLKSPSGSKRKALRIQEPEAP
QAREATNGAARRRSLPRELQFQQQERRGLFYGNYTPPDLPPIPSLQNLIQDCSKPFEKQL
ARSDVKDNQCRLSMNKEDVENNIMPLLRNGENLNEGINVTTYDMTGNEYPMVFKIWATKV
HVLTGGWKTFCNDLGLVENQDFVTLWIFRHVDKGGLCFAIHSRRLPSVIVSFSQNM
Download sequence
Identical sequences M5VX51
ppa015816m|PACid:17656975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]