SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa016432m|PACid:17660119 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa016432m|PACid:17660119
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.04e-18
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 128-199
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000116
Family B3 DNA binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa016432m|PACid:17660119
Sequence length 204
Sequence
RVPKTFLDKCGEHLSDQIHLKLPCGSEWKIKLRRCNGEVWLGKGWPEFSEFYSLKKGNSL
LFRYEGNSKFNVLIFDESGTEMDYPITITLIEETDEEKSRTNPHSSSRPSSSSSSKRVHV
EAANEFVSSHPFFKVTLRKHLGMNIPASFRKHFTTVENQIVRLWVGDRSWTVKLIFHRNN
DQLSAGWRAFLKENLLKKRRCLHL
Download sequence
Identical sequences M5VMB0
ppa016432m|PACid:17660119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]