SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa017553m|PACid:17650985 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa017553m|PACid:17650985
Domain Number 1 Region: 86-197
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000102
Family B3 DNA binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa017553m|PACid:17650985
Sequence length 200
Sequence
MEDDYETSKMLALTLSLLNTNPELDQVSTALTLCDPTWNYDTNQSKAEELDPATHNVPTF
PRNPNHEKISGTNDTNKEPSPKPRRPWPIRKILKASDLGNSSRLLVPKDSATNHFLRYLD
DKFVQRVESDEGLGVTVQDYDTGTRHQLTFKFWSSAKSYILNGEWRGMFVQRRGLKEKDE
IGLYWDASRAMFMFSLLQRA
Download sequence
Identical sequences M5WPL5
ppa017553m|PACid:17650985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]