SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa017776m|PACid:17645578 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa017776m|PACid:17645578
Domain Number 1 Region: 123-229
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.8e-19
Family B3 DNA binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa017776m|PACid:17645578
Sequence length 247
Sequence
MTCLINRKTEDPGYEDKEMKDSIKGAHDLLYLKHTILDYKTARKLEHMKSKILSGIELNS
PSGSKQKALRIQESEATNGAAQGRRELQFQQEGGGGLFYGHYAPPDLPPITSLRKLIQDC
CKPFEKQLTPSDVSKTPRLCLNKEYVENHIKPVLRDGENPNEGIDVTTYDMEGKEYPMKF
TTWGTDLYVLSKGWKTFCHDVGLVETQDFLTLCVFRHAKNGGLCFAIHSRRLPLFKSIKK
RRQRKQN
Download sequence
Identical sequences M5WG19
ppa017776m|PACid:17645578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]