SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa018532m|PACid:17645457 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa018532m|PACid:17645457
Domain Number 1 Region: 76-173
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000863
Family B3 DNA binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa018532m|PACid:17645457
Sequence length 176
Sequence
MEEKEASTTLTLGPATPCPQEKVSTELGLAAPCPQDEVSTELTLWTTNKKKRKPETECPV
PRKKTNTNLVSWLKPSEAWEIKKTLTPSDLENLLIVETNFIENQVMSFLGDTFSKRVLES
KYGARVTVHDRDTFSKHRMVLKLRDSPRRSYILDEDWQQEFVKRRELKEGDEIGVG
Download sequence
Identical sequences M5WD86
ppa018532m|PACid:17645457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]