SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa019336m|PACid:17651302 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa019336m|PACid:17651302
Domain Number 1 Region: 228-354
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000137
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa019336m|PACid:17651302
Sequence length 416
Sequence
MASSSLGSFNLSSRSKREGDEAEDKGKMGYLTMEDFKGMNFDSLCPYDQLTLVATVLVDK
TEQEKKQLKNEEHQIQSRPSSSPQVSSSSPNASPHFHPLVPGLVQGKYVNWVQQGYPKKP
RSASNFGQKSTINTSPPATVAAAATHDDHIQGRRSSNNYGLKRKSNDDHDDRDKDWAAPN
KKKEKKEKKKKVYIKNKKGATLHHRPDLPEDFKKMIIGQMNGIELTCLIQKELFPSDVNP
DLNRFSLPPNQVLFNDFLTPDEIEALKERKEKKNHDQGSLKSPSPSLKVPFIDPSLKLED
KEGINLTMWTLSNSETKTYVLRTTWGKVVSKNKLVAGDVIQVWSFRANNNQLHLAIVVVK
RAGKIGTNQSEGSSSKRGNVVDIGNECGGQGSRGVEGSSEVMYRSTPDSFVKEAGR
Download sequence
Identical sequences M5XA43
ppa019336m|PACid:17651302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]