SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa021765m|PACid:17658710 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa021765m|PACid:17658710
Domain Number 1 Region: 205-314
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000235
Family B3 DNA binding domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa021765m|PACid:17658710
Sequence length 320
Sequence
MGWHSSTDSDFDGIFNRKLTNMGWLLEIVRFDTEKYMQEDLLKQTSNINKEPNCPAAERE
SEIAEAAHPVAPSMVSSESKGEGLMKEKAFKNPALIEPKKQRSSDGPKLMHTAIASARKT
NSLKRKFQSRDDDDSTNWAPVECKKQRMMMMLKKKNANKGTSSINKITPKKKEELSSLSS
SAHHDLPEAFKRKIASLGGTKVALVIQKKLRKTDLSKSGNRMSMPLNQISSTDFLEDDER
GRLEKEETMKVQLIDPGLVQGDINLRRWNMKKMNGKNSKIYVLRTQWSDFAKRNHLKEKD
LVQVWSFRVNGALYLALALR
Download sequence
Identical sequences M5X3H5
ppa021765m|PACid:17658710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]