SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa022411m|PACid:17642992 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa022411m|PACid:17642992
Domain Number 1 Region: 91-205
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000432
Family B3 DNA binding domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa022411m|PACid:17642992
Sequence length 213
Sequence
MEEENELSALLALNPGRASSSANPCPLPGQVSTALTLCDPTWNYNTNQRKAEEFDPAPLR
FSAFPPNLKHKKITNNMNKELKKKKRNPDHGPWKIRKKLTVSDLGSCSRLLMPKKPVIDH
VLHYLDDTFAKRVKSGEGIEVIVEDCDTNTRHHMTFKLWGSAESYILNGDWRLEFVHRRG
LEENDKIGLYWDTSKSMFMFSVLERARQSQLPA
Download sequence
Identical sequences M5WC34
ppa022411m|PACid:17642992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]