SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa022488m|PACid:17665886 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa022488m|PACid:17665886
Domain Number 1 Region: 187-262
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000216
Family B3 DNA binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa022488m|PACid:17665886
Sequence length 268
Sequence
MDNFHPPSIPSTSTITSAPQEQHSQLSICEPMSCSPSTTCSPSTTQYYCYPAQYLAPNPG
LQFQYAYPYQQAGQPMYPFLVSGQPNVVVSTEQDSLARSGWTLDALVSKAARKERRMARQ
RSLSLSRNNANAAASSESSSPSSRRHAPFPWNEDDDQGSMSTSSSGAGTDMQNINRHLYT
FCTPDNKKEAEENLPMLSDKEGIQLMIRDVYSDQEWGLKYKYWSNNKSRMYLLENTGDFV
KQHKLEVGDCICLLEDEDKNLVSSSFLP
Download sequence
Identical sequences M5WK58
ppa022488m|PACid:17665886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]