SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa022948m|PACid:17640869 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa022948m|PACid:17640869
Domain Number 1 Region: 17-113
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.24e-22
Family B3 DNA binding domain 0.0054
Further Details:      
 
Domain Number 2 Region: 433-526
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1e-19
Family B3 DNA binding domain 0.0058
Further Details:      
 
Domain Number 3 Region: 230-330
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.44e-16
Family B3 DNA binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa022948m|PACid:17640869
Sequence length 534
Sequence
MTFLRREIHNWPKCYATNPHFFVMVPKGTCRESKLSIPKKFLRKYGDDLSNPVLLKLPNG
SKWNIELRRWEGEAWFDKGWPEFSEFYSLEHCHSLVFRYEGNSKFHICIFDKSFVEIEYP
LTMPDRKETDADDDSSDESDDHSDDASLEILDKFPPCPRKSKEKSSLPCPRPHKKKRTSS
SGNVDYPAKRHDRGTSSTPRFLKQTQVVRGRMHPLTTSGKALALQRAKAYKSDKPSFIVP
MHHSYIGRHPMWLTSDFSIFMGHLSKNSANVILWDLGGRAWVVEFIAKPRAKFQSGWHEF
VCGNNLNINDVCVFVLIDDTRLVFEVVIFRAVEAANCTLLPDVDGEETDEDDDSVDSLDE
LPPCSKTRKISPIAPQPHKKNRTCSTSKAKNIEHVCGSSKTRKFVIRRPEVPRMMHPVAA
SGKDRALLRANAYKSKYPSFTAAIHPTNICGCYLALPAKFVKEHLNQAHDKVILRVSDER
TWHVNLCKYGRAFRLQRWMRFVRENHLEVDDVCVFELINNIKPLFNIYFEKASM
Download sequence
Identical sequences M5WBU9
ppa022948m|PACid:17640869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]