SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa023581m|PACid:17654194 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa023581m|PACid:17654194
Domain Number 1 Region: 7-96,167-397
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 7.91e-77
Family IF2B-like 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa023581m|PACid:17654194
Sequence length 414
Sequence
MADVQGLVNDFATKLSKRKVEGSRETARMTAELLRTVISQQKMTSSTNHAAVLIDAVRGV
GGRLIDANPVELAVGNIVRRVLYIIREEELSLQAGELTLSSQDSDREIDEEDDKLFLSSA
ATYQRILHPPSLATLLGSKTDTPPACHPSASRNHDIEGKGNPSSLTLKRHIMEAVNDLIE
DIKTCHEQIADQAVELIHQNEVVLTLGHSRTVKKFLCAAKEKKRSFQVVVAEGAPKYLGH
VLAKGLAAKGLQTTMIADSSVFAMISRVNMVVVGVRAVLANGGVIAPVGINMVALAARKH
AVPFVVVAGTYKLCPLYPNNPEVLLNDMRCPSELLSFGEFSDCIDFSIGSEAPLLHVLNP
AFDYVPPELVSLFVTDTGGHTPSFIYRLISEFYSADDLALQQKLLPESEHSNSI
Download sequence
Identical sequences M5XIW6
ppa023581m|PACid:17654194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]