SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa023842m|PACid:17665296 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa023842m|PACid:17665296
Domain Number 1 Region: 114-219
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.3e-16
Family B3 DNA binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa023842m|PACid:17665296
Sequence length 241
Sequence
MTNGTEGAYLLLFLKHTILNPETARDLEHMKRKILSGIELNSPSRSKRKALRIQEPEAPR
ARESTNGAARGRSSPRELQFQQQERGGLFYGNYAPPDLPPIPSLQNLIQDCSKPFEKQLT
RSDVKEDQCRLSMNKEDVEYNIMPLLRNGDNFNEGIDVTTYDMAGTEYPMVFKIWATKIH
VLTGGWKTFCNDLGLVENQDFVTLWVFRHVDNGGLCFAIHSRRLPVFKPIKKRRPIRQKY
H
Download sequence
Identical sequences M5VSG9
ppa023842m|PACid:17665296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]