SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa025268m|PACid:17646245 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa025268m|PACid:17646245
Domain Number 1 Region: 432-706
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-68
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 25-173
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000000000368
Family Universal stress protein-like 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa025268m|PACid:17646245
Sequence length 776
Sequence
MWQAKGGNGTKKGAGGGGAAGNGLVAVAIDNQKGSQNALRWAAENVITRGQTVVLLHVVQ
KSSSTSSLAGNNALICDVSNPSQSPRKQQLEKMTKDLFLTFHCYCTRKDINCLDIVLEDT
DIAKAVTEYVSYAAIENLVLGAPAKHGFIRFKTSSIPSSVSKGAPDFCTVYVISKGKISS
VRNASRAAPYSSPLVNQIDSLNKQSFKPPETPRYNNILGLTRGGFSNGRISGGFSESESD
ISFISSERASTDRASSVTYDFMDTNRGRISTSSDQSFGSMHQGPKFADLSSLHDFSSVSH
ESNLTSSSWSSQNLEEVESEMRRLKLELKQTMDMYSTACREALSAKQKEMELHNWRVVEE
QKLEEARLGQEAAIAVAEKERVRCRAAMEAADAAKRIAQLESQKRANTEIKALREAEDMR
KLLDNLAQTDDKYRRYAIEEIEQATEHFAPSRKIGEGGYGPVFKCYLDHTPVAVKVLRPD
AAQGRTQFQKEIDILSCIRHPNMVLLLGACPEYGVLVYEYMANGSLEDCLIKRGNNPALS
WQLRFRIAAEIGTGLLFLHQTKPEPLVHRDLKPGNILLDHNYVSKISDVGLARLVPAVAE
NMTQCLMTATAGTFCYIDPEYQQTGMLGVKSDVYSLGIILLQLLTGRSPMGLAHHVDKAI
EKDTFEEMLDPAVPDWPVEEALSLAKLAIQCAELRRKDRPDLGTVVLPSLNKWRELAEDK
MNHKLIDGNNGLSPHHSHVPDQQEVMSDPRLNNSGTSKSQSSTSSQIENQAEAGIE
Download sequence
Identical sequences M5WY59
ppa025268m|PACid:17646245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]