SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa025823m|PACid:17643038 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa025823m|PACid:17643038
Domain Number 1 Region: 1-468
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.96e-86
Family Acetyl-CoA synthetase-like 0.0000154
Further Details:      
 
Domain Number 2 Region: 680-1035
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.54e-38
Family Quinoprotein alcohol dehydrogenase-like 0.013
Further Details:      
 
Domain Number 3 Region: 486-548
Classification Level Classification E-value
Superfamily ACP-like 0.0000000489
Family Peptidyl carrier domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa025823m|PACid:17643038
Sequence length 1037
Sequence
MPPSAEYIVSVLSVLRCGEAFLPLDPSWPKQRLLSVISSANVDLIIASRTPFGFESDSNW
LPEACGGRVLWFSMEERKNGGIDWDWACKCESVKERPCWCYLMYTSGSTGKPKGVCGTEQ
GLLNRFLWMQELYPLFGDEVLLFKTGISFVDHLQEFLSAILTGCTLVIPPFNHLKRNVFS
LVDFLQAYFVNRLTAVPSLMRAILPSLQGRDDEQLPRSLDLLVLSGEVLPLSLWDKLSKM
LPRTAILNLYGSTEVSGDCTYFDCKRLPLILAADRLTTVPIGMPIFNCDVVLIGGDDVSN
EGEIYVAGVCNSSGYYSDSMVTPLDTVRLSQDSVCCSSVNGHKSQYYFRTGDFAKQLRSG
DLVFLGRKDRTIKLNGQRIALEEIEDTVRGHSEVIDAAVIFHKVQGELMLLVAFIILREG
IPKEIFGATIKSWMADKLPLAMIPGHIVVTESFPVSSSGKINYELLADSVFLAKHVEDGL
GDVGSSNLLQLVKTAFRDVLSVEEISDDDDFFTMGGNSIAAAHLSNNIGVDMRLIYCFPS
PSMLCTALLERKESLNINVSRDAKSKMNLEGGKPSFFHVHSDTPATVNFDEQRRLLRTLS
GRSEDNAIISKRLKLDSNINVAGDSSPANGYPWNSVAIYASCSFSRCNKVVYEGGSVVKD
IYQATCSVMVPKSRNVPMQESWKVYMGLCVDASPIIVHKGQDIYLFIGSHSHKFMCVNAR
SGSVQWEIKLEGRVECSAAILSDFTQVVVGCYRGKIYFLDFLNGNICWTFQTSGEVKSQP
VIDSQRQLIWCGSYDHNLYALDYKNHCCVYQLPCGGSIYGSPAIDEMNNILYVASTSGQM
TAISIAAFPFSILWLHGLEAPVFGSLAINSLNGNIICCLVDGHVLALDTSGSVIWRYRTA
GPIFAGACMSSALPFQALICSRDGSIYSLELETGDLLWQYNVKDPITSSAYVDEHLSLVS
DRSNLPDRLVCICSSSGSVYLLRVNSGVAKVANEPIDVEEFSRLDLAGDVFSSPVMIGGR
IFVGCRDDYIHCITVKA
Download sequence
Identical sequences M5XIE7
ppa025823m|PACid:17643038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]