SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa026423m|PACid:17656016 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa026423m|PACid:17656016
Domain Number 1 Region: 252-348
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000451
Family B3 DNA binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa026423m|PACid:17656016
Sequence length 364
Sequence
MADDHNEGPPDEFPAVISYIKRMLLDYESSNDELEGNNEPEENAQEALQMLEEFLLDQEV
QEESVPDQQMQETEVEVIAPEEQPQQVAQFSFNHVPPHLLPVQSPRDVIQFQEREQLEQG
SSSGINNYVPSCTSSIASLQGMAAQSQQPGQTSLYVPGSLPSLQEFGQFQEHAAQHHQEA
IAAAQGMAAQSQQLEQSSSYRGYVSFGLPPVPSLQHSTQFQEHAAQEAIAALQVEQVPRS
LQNLIGRCSEPFEKQLSGTDVALGSTSLTISKEDVKRHILPLLKANEVPEEGIQVTVYDI
AGEEYPMLFKRRRYRYFLVGPKWRRLYQRHGLEGDQHSLTFWAFRKVRPESLCFVITWRR
LPAR
Download sequence
Identical sequences M5VXB3
ppa026423m|PACid:17656016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]