SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppb018283m|PACid:17665952 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppb018283m|PACid:17665952
Domain Number 1 Region: 151-263
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000432
Family B3 DNA binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppb018283m|PACid:17665952
Sequence length 303
Sequence
MSFEDLKKIKSSLDSFDKIVEEVKAVSRNPVEQDQLLTERIVFNLIQSKARKAEASISKQ
NNYNQEKAASTSAGNYHMKIRKQTLGSNKDEDEFKCIEEEVSKLIKKKQNKAKKAVSMRA
PLSSIPSTPPDMPTEFKNKIQSLHGFRVQLVIQKEIFPTDLSPHHDRLSMPKNQVSNQDF
LGEQDKKKLKLEGSIRVKVIDPNLNEYELRLSEWKFKSRSCSGLSKRKRSSSYMLNSGWS
KISENKKNKLQKEDIIQVWSFRVNNVDNPPVYGEERLCFAVVRLTDTDEGKHCLIESDPT
SAS
Download sequence
Identical sequences M5W342
ppb018283m|PACid:17665952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]