SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppb024283m|PACid:17666892 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppb024283m|PACid:17666892
Domain Number 1 Region: 107-207
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.49e-23
Family B3 DNA binding domain 0.011
Further Details:      
 
Domain Number 2 Region: 262-361
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.71e-20
Family B3 DNA binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppb024283m|PACid:17666892
Sequence length 385
Sequence
MAKSKLSYEESRRQRLEENKKRMEALNLPQLAQALKTTSSPKPSPMKRTKPRTVEKQMVV
VVVDRVMIPRKSYSSRHRDLSNRVYASDEARAEAMERAENLESGLGSDHPIFVKTMLPSH
VSGGFWLGLQVQFCKEHLPKGDEVMTLIDEDGNEYPTIYLARKTGLSGGWKGFAVAHDLV
DGDALVFQLIRRTVFKVELARPRTFEKHLVQVRRSTRVSNHSSPVYKELAEGFVEPNKRF
CSDEARAAALHEAQELVSGLGSDNPTIVKTIVPSYISGGFFLCLKRQFCMENLSKGDEVM
TLVDVDGNEYLTRYLAQRFGLSAGWKEFAFAHDLVEGDALVFQLIRPTAFKVYIVRVKRS
EGSSAGSAWVKRSLGIGIRLAYVLQ
Download sequence
Identical sequences M5XC02
ppb024283m|PACid:17666892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]