SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppb024440m|PACid:17642731 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppb024440m|PACid:17642731
Domain Number 1 Region: 123-219
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.14e-24
Family B3 DNA binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppb024440m|PACid:17642731
Sequence length 222
Sequence
MVAANLSYEESRRQRMEENKKRMEALNLPQLAQALKAPSFPKPSPMKRAKPRTVEKQMVV
VRRSSRVANLPTPVYKEIAVDPLRMPRRHSTSKHRDFSNRVYASDEARAEATERAEELES
GLGSDHPTFVKPMLQSHVTGGFWLGLPIHFCNKNLPKRDESVILVDEDGDEYQIVYLANK
RGLSGGWRGFAIAHELVDGDALVFQLIRPKTFKVYIIRVERT
Download sequence
Identical sequences M5XAI5
ppb024440m|PACid:17642731 XP_007221765.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]