SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pmar_ATCC_18224:PMAA_008060.t1 from Penicillium marneffei ATCC 18224

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pmar_ATCC_18224:PMAA_008060.t1
Domain Number 1 Region: 19-67
Classification Level Classification E-value
Superfamily LysM domain 0.00000051
Family LysM domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pmar_ATCC_18224:PMAA_008060.t1
Sequence length 70
Comment gene=PMAA_008060 NW_002196669:60662..60874
Sequence
MATTTSVGSTQIRIAANCDEYHTVVIGDTFAVIENEDGITFTQLDEWNAAIRSNCETLDV
GYVVCVGLSS
Download sequence
Identical sequences B6QWF2
Pmar_ATCC_18224:PMAA_008060.t1 XP_002153671.1.75516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]