SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pmar_ATCC_18224:PMAA_101310.t1 from Penicillium marneffei ATCC 18224

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pmar_ATCC_18224:PMAA_101310.t1
Domain Number 1 Region: 21-87
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0000719
Family KorB DNA-binding domain-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pmar_ATCC_18224:PMAA_101310.t1
Sequence length 149
Comment gene=PMAA_101310 NW_002196664:complement(3029808..3030257)
Sequence
MQEYHKIDQVLDLQPCDKYINMAPIDLALEYIQVLDPKEKINYTQIAKKFGIDRSTLSSR
HRQITGSKEDQYYAQALLNKDQSEVLITLVNGLENRGVSITSSELAEFAKAICGKDPGKN
WASRWVKHHSDKLNSQKDKKGEDDAGDEA
Download sequence
Identical sequences B6QJY8
XP_002149713.1.75516 Pmar_ATCC_18224:PMAA_101310.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]