SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pmar_ATCC_18224:PMAA_085020.t2 from Penicillium marneffei ATCC 18224

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pmar_ATCC_18224:PMAA_085020.t2
Domain Number 1 Region: 82-157
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 9.29e-32
Family Skp1 dimerisation domain-like 0.0000269
Further Details:      
 
Domain Number 2 Region: 5-66
Classification Level Classification E-value
Superfamily POZ domain 1.36e-20
Family BTB/POZ domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pmar_ATCC_18224:PMAA_085020.t2
Sequence length 160
Comment gene=PMAA_085020 NW_002196663:complement(join(2294246..2294252,2294309..2294478,2294549..2294802,2294888..2294939))
Sequence
MSGQVTLQSSDSVDITVERAVAERSMLIKNLLEDLGESEEPVPIPNVNESVLKKVIEWCT
HHKNDPQSTGEDDDNRRRTTEIDEWDQKFMQVDQEMLFEIILAANYLDIKALLDVGCKTV
ANMIKGKSPEEIRKTFNIQNDFTPEEEDQIRRENEWAEDR
Download sequence
Identical sequences B6QGB9
XP_002148015.1.75516 XP_002148016.1.75516 Pmar_ATCC_18224:PMAA_085020.t1 Pmar_ATCC_18224:PMAA_085020.t2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]