SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|185719|fgenesh3_kg.1_#_67_#_867_1_CCFG_CCFH from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|185719|fgenesh3_kg.1_#_67_#_867_1_CCFG_CCFH
Domain Number 1 Region: 5-328
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.33e-51
Family Cystathionine synthase-like 0.0000725
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|185719|fgenesh3_kg.1_#_67_#_867_1_CCFG_CCFH
Sequence length 331
Sequence
MTSFYTPTPNRFKILCEAKAFPSDQYAFASQVLLHGYAPADAIIEVSPREGEFHLREEDI
LDIIDREGDTIALVLFSGVQYYTGQLFPMASITEKAKSKGCICGWDLAHGVGNVPLSLHD
WDVDFAVWCTYKYLNSGPGGIAGLFIHEKWNDEKKPMQAGWWGHELSTRFAMPPTFQPIP
GAQGFQQSNPSALTIASLLGSLQIYKSVGMMQPVRERSLKLTGALESFLKKSRYFVPLEQ
AIKHDSQGRPGFTIITPSDPNMRGSQLSLLFLPQGSEVMRNVFKSLNSYGVIGDKREPDV
IRLTPAPLYGSLKDCEEGAAWLEKAFEEQEA
Download sequence
Identical sequences jgi|PleosPC15_1|185719|fgenesh3_kg.1_#_67_#_867_1_CCFG_CCFH

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]