SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|41915|estExt_Genewise1Plus.C_110123 from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|41915|estExt_Genewise1Plus.C_110123
Domain Number 1 Region: 39-424
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.38e-99
Family Cystathionine synthase-like 0.0000000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|41915|estExt_Genewise1Plus.C_110123
Sequence length 431
Sequence
MSPSIIHASNQSVSTNGHSNGHTNGSVSKKSSQHGGFGTRAIHVGSEPSEETGAVIPAIS
LSTTYKQDAVGVHKGYEYTRSLNPNRAALERTLAALESGGSYALTFASGSATTGIVLQSL
GPGAHVLSVNDVYGGTFRYMTRVAKELQGLEVDFLDLENASDDEIIGAIRPNTKLIWIES
PTNPTLRLIDIAKISRLAKSHPSQPLVLVDNTFLSPFYSSPLLLGADLVMHSMTKYINGH
SDVLMGALILPASHRHLAVYEKLQFLQNASGAVPSPYDCWLAQRGAKTLHLRMKAHGENA
LQVARALQRSEHVEEVIYPGLKTHARNQLAYKSLSAHAKNGMISFRIRGDEATAERFLTS
TRLFTLAESLGGVESLAEHPARMTHGSIPPAERAILGIGDNLIRLSVGVEDADDLVEDIE
QALELAVHSNV
Download sequence
Identical sequences jgi|PleosPC15_1|41915|estExt_Genewise1Plus.C_110123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]