SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|42000|estExt_Genewise1Plus.C_110458 from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|42000|estExt_Genewise1Plus.C_110458
Domain Number 1 Region: 5-462
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.57e-165
Family GABA-aminotransferase-like 0.000000000503
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|42000|estExt_Genewise1Plus.C_110458
Sequence length 477
Sequence
MASTDFNKMLYTPLPEADPVVQNIIDKEVWRQFTGLELIASENLTSRAAMDANGSILTNK
YSEGLPNARYYGGNEYIDELEILCRKRALEAFHLDPAKWGVNVQPYSGSTANFAALTALI
QPQDRLMGLGLPDGGHLTHGYYTAKKKMTASSIYFQSLPYAITKDTHLIDYVALAEQARI
FKPKLIICGASAYPRDWDYAAIKKVTEKEGAFLMCDMAHTSGLVAAQELNDPFEYCDVVT
TTTHKTLRGPRAGLIFFRKDLPNSPDLEKRVNEAVFPACQGGPHNNTIAAVAVALKQVAD
PAFKQYAKQVIANARTLGARLVEHGYKLQTGGTDNHLVLWDLRPLGLTGSKVEKVCDLMG
ITINKNAVSGDASAQVPGGIRLGTSALTSRNMLEADVKQVADFLHRAVQLSLLLQKEAGS
KLLKDFVRVATSQEEGKQGFAQVKQLRDEVQKFATKWPLPGVDVTTLKKPEGLHELL
Download sequence
Identical sequences A0A067N3J5
jgi|PleosPC15_1|42000|estExt_Genewise1Plus.C_110458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]