SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|53328|fgenesh1_pm.C_scaffold_12000093 from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|53328|fgenesh1_pm.C_scaffold_12000093
Domain Number 1 Region: 11-431
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.6e-125
Family Cystathionine synthase-like 0.00000000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|53328|fgenesh1_pm.C_scaffold_12000093
Sequence length 436
Sequence
MANPFYKEPEFDTLQLHAGQEPDPTTNARAVPIYATTSFVFNDSAHGADLFGLKTFGNIY
SRIGNPTVDVFEKRVAALEGGAAAVATSSGQSAQFLAISALAGSGDNIVSSSFLYGGTYN
QFKVTFKKFGIGVKWVTENDPAAYEAAIDENTKAIFIESIANPKYVVADIPALAEVAHKH
GIPLVVDNTFGMAGYLIRPISLGADIIVHSATKWIGGHGTTIAGVIVDSGNFDWTKSTKF
PGFTSPSEGYHGLVFAETFGSVAFAVKVRTELLRDIGPALNPFAAFLLLQGLETLSLRGQ
RHSDNALALAQWLEQHPSVAWVSYLGLPSHPSNAIAQKLLRAKNAYGGVLSFGVKADAAT
ASKVVDSLKLASNLANVGDAKTLVIHPATTTHQQLSDEEQLASGVTPDLIRVSVGIEAIS
DIIADFAEALKVIPSP
Download sequence
Identical sequences A0A067NFB4
jgi|PleosPC15_1|53328|fgenesh1_pm.C_scaffold_12000093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]