SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PTSG_00099T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00099T0
Domain Number 1 Region: 797-996
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000687
Family Tropomyosin 0.0038
Further Details:      
 
Domain Number 2 Region: 600-727
Classification Level Classification E-value
Superfamily Tropomyosin 0.000085
Family Tropomyosin 0.022
Further Details:      
 
Weak hits

Sequence:  PTSG_00099T0
Domain Number - Region: 151-295
Classification Level Classification E-value
Superfamily Tropomyosin 0.000203
Family Tropomyosin 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_00099T0
Sequence length 1186
Comment | PTSG_00099 | Salpingoeca rosetta predicted protein (1187 aa)
Sequence
MVTLLDTLQQEVERLQQRLKAQREAYEKQFEDLEHAHEQELQDMEARYRHQLQRHIDAFK
ETVLFHQQHHGGHLHMDGDTAAATTTTTTTADLMTSLLQDVMDTTASMDPASSPRSKASN
TSRLLSSAVRTANGDDATHHDFGDNGTDRHSLQREMDAMQARHAADMEQLEAAMERQKRQ
HQQLLADETARADTLQAEVDALNQRIDLLDSALAAKQDVLDSVRAGYERDAHLREQAMQQ
LEAQLQDLAREQKSSTSTRTAELQRALDDKAALHADLARAKTRVAQLQRMLKQLQLPHAS
DTFAATATTPAATQHLNNTTLGFDEQGRSSTMMPVQSTANLSSSSSFMAATARHDSTQQQ
AQHDPLSQTLPASLSMKPDGPAAAAFARSTEYTVRALLHNRTQLQEEIARLKQELTQVRA
SKIKLVEDLTKDREELKQRHAQHVTEVQSALDSNATQLTGAHSTLAALEEALDRQYNALM
AEQAAARATATRTAPTPPYSHHSGGNASATNSNPSIGSYSSASAAMAAAAAAAADGVRPS
TMVLLQSRALPPAHVLASAYASTSTSTSTTASLSSSASVPQQHLMAVLNAFGKVRTALDN
ISVEFAQLSRKHEMAQQELIALRSQVAASQTRCHDLSTQEQETKGAMDALRAQCATLQSQ
KESLERHNADMTRHLQAAQRRAGELEAEADRAASEAQSRLQRSEDDAKQRVAGVQQQVKA
FKAELQSALGVKTAVESQLGEALRDNMKLREETERLAKTATEQEATARRLQERHDFSLER
AKKLEQELASTKTAKEHAEQQLHALQAEADALRSRAQETDRAVQTANAEQAALQQQAAKL
RGKVAVLKQKNEALSDAETQLQAALVARDAAHSEIAQLRRQIADTHARKEQAEEEAQRTA
HANRAVVDDLTRQLQVARTRARNAEEAVSALAEKAQHFETRAVHAERDARAARDESEHAS
TQLHDLQQQLSSKEREAAKLKREYAELQYRVDRLYASNQQLLRDRRTQHARLLDKMKRHF
ASQMTSLSTLGKYGSGRATPAGTQVTAQLDKSAGTAVPLHAHAMTEREATATSTTPATNT
ATARGQAVQFSAEVAAPHDHHHDNQQELLHQQQQQQQQQQHQRQHQEQEGPEEQEQQGWH
VGQQDAGDGTHEEVATARVDVSQDEEDSDESLRSDADEDVQHLLME
Download sequence
Identical sequences F2TVI6
XP_004998654.1.12839 PTSG_00099T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]