SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PTSG_04811T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04811T0
Domain Number 1 Region: 1187-1231
Classification Level Classification E-value
Superfamily GRIP domain 0.00000011
Family GRIP domain 0.0024
Further Details:      
 
Domain Number 2 Region: 230-502
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000183
Family Tropomyosin 0.0009
Further Details:      
 
Domain Number 3 Region: 101-279
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000883
Family Tropomyosin 0.002
Further Details:      
 
Weak hits

Sequence:  PTSG_04811T0
Domain Number - Region: 661-759
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0445
Family Myosin rod fragments 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_04811T0
Sequence length 1317
Comment | PTSG_04811 | Salpingoeca rosetta predicted protein (1318 aa)
Sequence
MKAQLEQQLSEVSESRTQLEQQLSEVSESKTQLEQQLSEVSESQEGATQEANARIAELEQ
QLNEVSESKTQLEQQLSEVSESRTQLEQQLSEVSESQEGATQEANTRIAELEQQLNEASE
SRTQLEQQLSEVSESRTQLEQQLSEVSESKTHLEQQLSEVSESRTQLEQQLSEVSESRTQ
LVQQLSEASESKTQLEQQLNEVSESRTQLEQQLSEVSESQEGATQEANARIAELEQQLNE
VSESRTQLEQQLNEVSESKTHLEQQLNEVSESKTHLEQQLNEVSESKTQLEQQLSEVSES
RTQLEQQLSEVSESRTQLEQQLSEVSESRTQLEQQLNEVSESRTQLEQQLSEVSESQEGA
TQEANTRIAELEQQLNEVSESQEGATQEANTRIAELEQQLNEVSESRTQLEQQLNEVSES
RTQLEQQLNASSQANESALQQKYDRLLAKARQLKERWTAAQQEVAAERERTKQLSGELQQ
LRDNRAAQDKAAGARMDELEQHLATASAKCDELQLQLEQERADHAVSAQAMQEDMDTHAK
RADSAEAAATEKEEQLVAAQTRLAAVEEEADSLRVQVETAQQHAAESDQSVALSARVDEL
TSLLASREAELQEAHVRFTKLRAKAKSLVAGAKKAEALEQDVQVLRGELDAAAADTRTAQ
EAHEEAMTCLQAELEGIKEQLAKAEAEKQHVCEKRDALQTEVERLSAAVDEMKAALSEVE
SGSQSQLEEARSEAASLREQLGEVNARLATLQEQVEGEDLERDAARREADEATEALERVR
AEMEDWKQVAEQRTAELQRAHESFTKLKQRAKRVTKERNDLQAALDDARQHAENAGATAR
GEVEELTARVEQLVKEKEEVQARADERKQELLEEMQALREEMEILQSETEELSATAREAK
EREGEAKSRVEMLEEEGRAVRQQLLEAKVDADELQKEFEEETEQLQAALEASEKTCADMK
QKYSNVDLVLEELRTTVTQLEVEKDEREKEWEVERAQLAAAADESSAAASDVQEQVAALE
AKTKALSTENDDLKRVIQAKRAKIMALERDLVQFQEQLKLERERFAASAAAASALAHEEE
MEAVRRDLKVIREHAEDQHRRADNEKDMRLHEQEKHDAKLAEMQRWHDEKLAALRQEVAT
LQEQLSAAKQQQAPQRAEQEEAAQATATSSSKPAPPPTAHADGSAVDIDYLRNVVYQYMM
GIHADEVAHIIASVLEFSPEQRRDLFADEDDNSDDDDASGGDGDGHDAATSGRRTADELF
GALSSLQSRVQNASKPFLANLTTSLGFLAQQQQQQERQEEQGGERAEEEEHHQQHKQ
Download sequence
Identical sequences F2U9S1
XP_004994129.1.12839 PTSG_04811T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]