SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479168332|ref|YP_007796831.1| from Coprococcus sp. ART55/1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479168332|ref|YP_007796831.1|
Domain Number 1 Region: 58-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 6.41e-26
Family Ribosomal protein L9 C-domain 0.0001
Further Details:      
 
Domain Number 2 Region: 1-55
Classification Level Classification E-value
Superfamily L9 N-domain-like 1.52e-17
Family Ribosomal protein L9 N-domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479168332|ref|YP_007796831.1|
Sequence length 148
Comment LSU ribosomal protein L9P [Coprococcus sp. ART55/1]
Sequence
MKVILLQDVKSLGKKGAMVEVNEGYARNFIIPKKLGMEATPKNMNDFKLRKAHEEKVAAE
NLADAKALAAELEKASVTVKIKVGEGGRTFGSVSTKEISDAIKSQLGKDIDKKKIVMKDS
IKALGSFSVKVKLHPEVQAELAVKVEEA
Download sequence
Identical sequences A0A173X658 A0A1Q6P3K7 D5HF17
gi|479168332|ref|YP_007796831.1| WP_015534512.1.35782 WP_015534512.1.63492 WP_015534512.1.80485 WP_015534512.1.90043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]