SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479167676|ref|YP_007796175.1| from Coprococcus sp. ART55/1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479167676|ref|YP_007796175.1|
Domain Number 1 Region: 120-271
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 5.1e-52
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.0000691
Further Details:      
 
Domain Number 2 Region: 2-119
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 9.64e-36
Family DHN aldolase/epimerase 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479167676|ref|YP_007796175.1|
Sequence length 272
Comment dihydroneopterin aldolase/2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase [Coprococcus sp. ART55/1]
Sequence
MDSINIKGLEVFAHHGVYREENVLGQKFVVDVSMQVSTQEAGRSDDIRKSVNYGSVCDGI
QKVMKNRNYKLIETVAEEIADMILLTYDDVRGVNVTVKKPWAPVMVHVDTVSVSISRKKH
TAYLGLGSNIGDRESYLDMAIDELNKDKYTKVTRVSDFIETEPYGGVEQDDFLNGCLEIE
TLRTPEELLRLVNGIEKAAGRERLIHWGPRTLDIDILLYDDVVYDSEDLHIPHVEMHKRE
FVLEPLSAIAGYKRHPLLGKTISELRAGLDKQ
Download sequence
Identical sequences A0A174C501 A0A1Q6MEK3 D5HJ89
gi|479167676|ref|YP_007796175.1| WP_015533886.1.63492 WP_015533886.1.90043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]