SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PH01000044G1970 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000044G1970
Domain Number 1 Region: 220-326
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.97e-31
Family Ankyrin repeat 0.00031
Further Details:      
 
Domain Number 2 Region: 90-177
Classification Level Classification E-value
Superfamily Acyl-CoA binding protein 1.44e-26
Family Acyl-CoA binding protein 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PH01000044G1970
Sequence length 336
Comment PH_genemodel_v1 PH01000044..1427705..1431364 . + . ID=PH01000044G1970;Name=acyl-CoA-binding domain-containing protein 6, putative, expressed
Sequence
MGGDWQELAQAAVIGLVFAFLVAKLISIVIAFKEDNLRVTRSPPTSPTPSSSLAPPATPT
PAAPPPTSREGHGDISDGSDSDWEGVESTELDEEFSAASAFVAASAASGTSVPEEAQLRL
YGLYKIATEGPCTAPQPSALKLKSRAKWNAWHKLGVMPTEEAMQEYITIVDELFPNWAVG
SSAKKKDEDSTVSASGSKGPMGPVFSSLMYEEDQGNESELGDIHVSAREGAMDDIEKHLA
AGIEVNLRDSEGRTPLHWAVDRGHLNAAEILVNANADVNAQDNEGQTALHYAVLCEREDI
AELLVKHHADLQMKDEDGNTARDLCSSTWSFMKLAN
Download sequence
Identical sequences PH01000044G1970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]