SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PH01001154G0590 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01001154G0590
Domain Number 1 Region: 167-191
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000628
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PH01001154G0590
Sequence length 244
Comment PH_genemodel_v1 PH01001154..396964..401847 . - . ID=PH01001154G0590;Name=OsIAA30 - Auxin-responsive Aux/IAA gene family member, expressed
Sequence
MAADLGFEETELRLGLPGGGGGGGDGEARSSSGKRGFAETIDLKLKLEPSAAAVDEKEAA
EEGDAAAATSPAAAGNMKRSPSQSSAVAAQPDPEKPRAPKAQVVGWPPVRSFRKNILAVQ
AEKGAVKEDGDKSSSAAHGRRAVPAQGNCGSQGMNGMNESKLMDLLNGSEYVPTYEDKDG
DWMLVGDVPWDTKGNGEMQEQKLRRTCTECLNQMQEPTYTFAALLCLLISVSYSLSSKSV
PPDQ
Download sequence
Identical sequences PH01001154G0590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]