SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PH01003333G0020 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01003333G0020
Domain Number 1 Region: 52-147
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000118
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PH01003333G0020
Sequence length 176
Comment PH_genemodel_v1 PH01003333..15011..16522 . - . ID=PH01003333G0020;Name=OsIAA22 - Auxin-responsive Aux/IAA gene family member
Sequence
MTRENRPAAAPQLVGWPPVRTFRKKLSTPKSADVDDLSKAKPSSEEVHGSGAARDEWSTM
FVKVNLEGYAVGRKIDLKAYRSYDALSRALQSMFHGFLSDGYGRIATREDDEEQVLEKGK
VGPKYILLYEDNEGDRMLVGDVPWEYLQADQASVCLPVCRLQLTRGEMARADDILM
Download sequence
Identical sequences PH01003333G0020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]