SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01000014G0610 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000014G0610
Domain Number 1 Region: 103-145
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000746
Family Type II restriction endonuclease effector domain 0.048
Further Details:      
 
Domain Number 2 Region: 205-278
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000654
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PH01000014G0610
Sequence length 427
Comment PH_genemodel_v1 PH01000014..384006..387135 . + . ID=PH01000014G0610;Name=auxin response factor, putative, expressed
Sequence
MKDRGSGGVSPGPAEGEKKAINSELWHACAGPLVSLPPVAASMHKEIDSIPSYPSLPSKL
ICKLLSLTLHADSETDEVYAQMTLQPVNKYDRDAMLASELGLKENKQPAEFFCKTLTASD
TSTHGGFSVPRRAAEKIFPPLGKNFDRTLRCNHQPKSSLPRISMTFRGNFDMFIEEVCVL
AYWDMVADQSTALCTYPPTVPAHAHAGQPKRHLLTTGWSVFVSTKRLLAGDSVLFIRDEK
SQLLLGTRHATRPQPALSSSVLSSDSMHIGILAAAAHAAANSSPFTIFYNPRTMNSYYSL
DRASPSEFVVPLAKYNKALYTQVSLGMRFRMLFETEDSGVRRYMGTITGIGDLDPVRWKN
SHWRNLQVGWDESTVSERRTRVSIWEIEPVATPFYICPPPFFRPKLPKQPGMPGNNAICR
QSQPLGI
Download sequence
Identical sequences PH01000014G0610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]