SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01000025G0410 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000025G0410
Domain Number 1 Region: 25-119
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-21
Family B3 DNA binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 224-326
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-20
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 3 Region: 372-470
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000667
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PH01000025G0410
Sequence length 475
Comment PH_genemodel_v1 PH01000025..335642..338722 . + . ID=PH01000025G0410;Name=B3 DNA binding domain containing protein
Sequence
MDKCHTEWKKYVAHHCWQHMDDLDKSFFKFMMGDFRSGLTIPQKFALNFRGQISEVVKLE
TRDGNTYNVQVTKELNNLVLRSGWVKFANAYELEEGDLLVFFLSGDSQFEVLIYDRSTCR
KELSCVVMNHFPCVHERSTSHDNHMQSPKSGRLAKRRKTSKRNPADCPLQKSTERDLPPS
GGIQDTTNSGGLHTSTKYHYILATGCNLTRAHKAKVDALELKIRPEIPLYVTALNETSLF
YGYLVICKDYAVQHLPHRDETITLCHPSNSKTWDADFKISTDGTYILSAGWLGFVRDNKL
QEDDVCIFEVSKSQRRDTMTVHMLKASYHPPDGITSSGSTMYGDSPLGYVVSQKTHLNDQ
QKSKIGKMVEAIQSETPIFVFVKGHGGNYSLTFKKDYAVKYLPDKEQNVWLRRPEKNSTD
WEAKFEIRNNTRRLCGWTKFVTDNQLRPGDICLFERLKMKELTMNVHIIRGEREV
Download sequence
Identical sequences PH01000025G0410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]